Recombinant Full Length Human IL36RN Protein, GST-tagged

• Cat.No.: IL36RN-5788HF
• Product Overview: Human IL36RN full-length ORF ( NP_036407.1, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 155 amino acids
• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. [provided by RefSeq
• Molecular Mass: 43.4 kDa
• AA Sequence: MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IL36RN interleukin 36 receptor antagonist [ Homo sapiens ]
• Official Symbol: IL36RN
• Synonyms: IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP
• Gene ID: 26525
• mRNA Refseq: NM_012275
• Protein Refseq: NP_036407
• MIM: 605507
• UniProt ID: Q9UBH0