Recombinant Full Length Human IFIT3 Protein, C-Flag-tagged
Cat.No. : | IFIT3-1290HFL |
Product Overview : | Recombinant Full Length Human IFIT3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables identical protein binding activity. Involved in negative regulation of apoptotic process; negative regulation of cell population proliferation; and response to virus. Located in cytosol and mitochondrion. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 55.8 kDa |
AA Sequence : | MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | IFIT3 interferon induced protein with tetratricopeptide repeats 3 [ Homo sapiens (human) ] |
Official Symbol | IFIT3 |
Synonyms | P60; IRG2; IFI60; IFIT4; ISG60; RIG-G; cig41; CIG-49; GARG-49 |
Gene ID | 3437 |
mRNA Refseq | NM_001031683.4 |
Protein Refseq | NP_001026853.1 |
MIM | 604650 |
UniProt ID | O14879 |
◆ Recombinant Proteins | ||
IFIT3-7755H | Recombinant Human IFIT3 protein, His-tagged | +Inquiry |
IFIT3-3066H | Recombinant Human IFIT3 protein, His-SUMO-tagged | +Inquiry |
IFIT3-2450H | Recombinant Human IFIT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IFIT3-1290HFL | Recombinant Full Length Human IFIT3 Protein, C-Flag-tagged | +Inquiry |
IFIT3-1145H | Recombinant Human IFIT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFIT3-5285HCL | Recombinant Human IFIT3 293 Cell Lysate | +Inquiry |
IFIT3-5286HCL | Recombinant Human IFIT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFIT3 Products
Required fields are marked with *
My Review for All IFIT3 Products
Required fields are marked with *
0
Inquiry Basket