Recombinant Full Length Human IDO2 Protein, C-Flag-tagged
Cat.No. : | IDO2-1929HFL |
Product Overview : | Recombinant Full Length Human IDO2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway. |
Source : | Mammalian cells |
Species : | Human |
Tag : | Flag |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAH QLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNLGLPPI LVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGFILVTALVEKEAVPGIKALVQATNAILQPNQ EALLQALQRLRLSIQDITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGS AAQSTVLHAFDEFLGIRHSKESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCV QALAELRSYHITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Metabolic pathways, Tryptophan metabolism |
Full Length : | Full L. |
Gene Name | IDO2 indoleamine 2,3-dioxygenase 2 [ Homo sapiens (human) ] |
Official Symbol | IDO2 |
Synonyms | INDOL1 |
Gene ID | 169355 |
mRNA Refseq | NM_194294.5 |
Protein Refseq | NP_919270.3 |
MIM | 612129 |
UniProt ID | Q6ZQW0 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IDO2 Products
Required fields are marked with *
My Review for All IDO2 Products
Required fields are marked with *
0
Inquiry Basket