Recombinant Full Length Human IDH3A Protein
Cat.No. : | IDH3A-251HF |
Product Overview : | Recombinant full length Human IDH3A with N-terminal proprietary tag. Mol Wt 66 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 366 amino acids |
Description : | Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. |
Form : | Liquid |
Molecular Mass : | 66.000kDa |
AA Sequence : | MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGD GIGPEISAAVMKIFDAAKAPIQWEERNVTAIQGPGGKWMI PSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL YANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVI VDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHK ANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMV QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGA NGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGL FDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICR RVKDLD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | IDH3A isocitrate dehydrogenase 3 (NAD+) alpha [ Homo sapiens ] |
Official Symbol | IDH3A |
Synonyms | IDH3A; isocitrate dehydrogenase 3 (NAD+) alpha; isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial; H IDH alpha; isocitrate dehydrogenase (NAD+) alpha chain; isocitrate dehydrogenase [NAD] subunit alpha; mitochondrial; isocitric dehydrogenase; NA |
Gene ID | 3419 |
mRNA Refseq | NM_005530 |
Protein Refseq | NP_005521 |
MIM | 601149 |
UniProt ID | P50213 |
◆ Recombinant Proteins | ||
IDH3A-28925TH | Recombinant Human IDH3A | +Inquiry |
IDH3A-7986M | Recombinant Mouse IDH3A Protein | +Inquiry |
IDH3A-2014R | Recombinant Rhesus Macaque IDH3A Protein, His (Fc)-Avi-tagged | +Inquiry |
IDH3A-11188Z | Recombinant Zebrafish IDH3A | +Inquiry |
IDH3A-1349HFL | Recombinant Full Length Human IDH3A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IDH3A-5305HCL | Recombinant Human IDH3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IDH3A Products
Required fields are marked with *
My Review for All IDH3A Products
Required fields are marked with *
0
Inquiry Basket