Recombinant Full Length Human ID3 Protein, C-Flag-tagged

• Cat.No.: ID3-1176HFL
• Product Overview: Recombinant Full Length Human ID3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 12.8 kDa
• AA Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL
  QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: ID3 inhibitor of DNA binding 3 [ Homo sapiens (human) ]
• Official Symbol: ID3
• Synonyms: HEIR-1; bHLHb25
• Gene ID: 3399
• mRNA Refseq: NM_002167.5
• Protein Refseq: NP_002158.3
• MIM: 600277
• UniProt ID: Q02535