Recombinant Full Length Human HTR1E Protein, GST-tagged
Cat.No. : | HTR1E-5680HF |
Product Overview : | Human HTR1E full-length ORF ( NP_000856, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 365 amino acids |
Description : | HTR1E (5-Hydroxytryptamine Receptor 1E) is a Protein Coding gene. Diseases associated with HTR1E include Attention Deficit-Hyperactivity Disorder. Among its related pathways are Serotonergic synapse and Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and serotonin binding. An important paralog of this gene is HTR1F. |
Molecular Mass : | 65.67 kDa |
AA Sequence : | MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYLICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDRYWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHVIYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIRCREHT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HTR1E 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled [ Homo sapiens ] |
Official Symbol | HTR1E |
Synonyms | HTR1E; 5-hydroxytryptamine (serotonin) receptor 1E, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1E; 5-hydroxytryptamine receptor 1E; 5 HT1E; S31; 5-HT-1E; serotonin receptor 1E; 5-HT1E; |
Gene ID | 3354 |
mRNA Refseq | NM_000865 |
Protein Refseq | NP_000856 |
MIM | 182132 |
UniProt ID | P28566 |
◆ Recombinant Proteins | ||
RFL17577HF | Recombinant Full Length Human 5-Hydroxytryptamine Receptor 1E(Htr1E) Protein, His-Tagged | +Inquiry |
HTR1E-1089HFL | Recombinant Human HTR1E protein, His&Flag-tagged | +Inquiry |
HTR1E-5678HF | Recombinant Full Length Human HTR1E Protein | +Inquiry |
RFL27491PF | Recombinant Full Length Pan Troglodytes 5-Hydroxytryptamine Receptor 1E(Htr1E) Protein, His-Tagged | +Inquiry |
HTR1E-5247H | Recombinant Human HTR1E Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HTR1E-5336HCL | Recombinant Human HTR1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HTR1E Products
Required fields are marked with *
My Review for All HTR1E Products
Required fields are marked with *
0
Inquiry Basket