Recombinant Full Length Human HSP90AB1 Protein, C-Flag-tagged
Cat.No. : | HSP90AB1-681HFL |
Product Overview : | Recombinant Full Length Human HSP90AB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. This gene encodes the constitutive form of the cytosolic 90 kDa heat-shock protein and is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 83.1 kDa |
AA Sequence : | MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKE LKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVA EKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIG YPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQE ELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKK NNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGES KEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKF ENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINP DHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEP NAAVPDEIPPLEGDEDASRMEEVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways : | Antigen processing and presentation, NOD-like receptor signaling pathway, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer |
Full Length : | Full L. |
Gene Name | HSP90AB1 heat shock protein 90 alpha family class B member 1 [ Homo sapiens (human) ] |
Official Symbol | HSP90AB1 |
Synonyms | HSP84; HSPC2; HSPCB; D6S182; HSP90B |
Gene ID | 3326 |
mRNA Refseq | NM_007355.4 |
Protein Refseq | NP_031381.2 |
MIM | 140572 |
UniProt ID | P08238 |
◆ Recombinant Proteins | ||
HSP90AB1-2940R | Recombinant Rat HSP90AB1 Protein | +Inquiry |
HSP90AB1-4350M | Recombinant Mouse HSP90AB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSP90AB1-13979H | Recombinant Human HSP90AB1, GST-tagged | +Inquiry |
HSP90AB1-8897Z | Recombinant Zebrafish HSP90AB1 | +Inquiry |
HSP90AB1-2161R | Recombinant Rhesus monkey HSP90AB1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSP90AB1-5361HCL | Recombinant Human HSP90AB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSP90AB1 Products
Required fields are marked with *
My Review for All HSP90AB1 Products
Required fields are marked with *
0
Inquiry Basket