Recombinant Full Length Human HSD17B3 Protein, C-Flag-tagged
Cat.No. : | HSD17B3-1439HFL |
Product Overview : | Recombinant Full Length Human HSD17B3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.3 kDa |
AA Sequence : | MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAK RGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLP SHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSK ALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSL IPAWAFYSGAFQRLLLTHYVAYLKLNTKVRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Androgen and estrogen metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | HSD17B3 hydroxysteroid 17-beta dehydrogenase 3 [ Homo sapiens (human) ] |
Official Symbol | HSD17B3 |
Synonyms | EDH17B3; SDR12C2 |
Gene ID | 3293 |
mRNA Refseq | NM_000197.2 |
Protein Refseq | NP_000188.1 |
MIM | 605573 |
UniProt ID | P37058 |
◆ Recombinant Proteins | ||
HSD17B3-1105H | Recombinant Human HSD17B3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B3-7878M | Recombinant Mouse HSD17B3 Protein | +Inquiry |
HSD17B3-2582R | Recombinant Rat HSD17B3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B3-2927R | Recombinant Rat HSD17B3 Protein | +Inquiry |
HSD17B3-1976R | Recombinant Rhesus Macaque HSD17B3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B3-5374HCL | Recombinant Human HSD17B3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B3 Products
Required fields are marked with *
My Review for All HSD17B3 Products
Required fields are marked with *
0
Inquiry Basket