Recombinant Full Length Human HSD17B2 Protein, C-Flag-tagged
Cat.No. : | HSD17B2-99HFL |
Product Overview : | Recombinant Full Length Human HSD17B2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Capable of catalyzing the interconversion of testosterone and androstenedione, as well as estradiol and estrone. Also has 20-alpha-HSD activity. Uses NADH while EDH17B3 uses NADPH. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42.6 kDa |
AA Sequence : | MSTFFSDTAWICLAVPTVLCGTVFCKYKKSSGQLWSWMVCLAGLCAVCLLILSPFWGLILFSVSCFLMYT YLSGQELLPVDQKAVLVTGGDCGLGHALCKYLDELGFTVFAGVLNENGPGAEELRRTCSPRLSVLQMDIT KPVQIKDAYSKVAAMLQDRGLWAVINNAGVLGFPTDGELLLMTDYKQCMAVNFFGTVEVTKTFLPLLRKS KGRLVNVSSMGGGAPMERLASYGSSKAAVTMFSSVMRLELSKWGIKVASIQPGGFLTNIAGTSDKWEKLE KDILDHLPAEVQEDYGQDYILAQRNFLLLINSLASKDFSPVLRDIQHAILAKSPFAYYTPGKGAYLWICL AHYLPIGIYDYFAKRHFGQDKPMPRALRMPNYKKKATTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Androgen and estrogen metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | HSD17B2 hydroxysteroid 17-beta dehydrogenase 2 [ Homo sapiens (human) ] |
Official Symbol | HSD17B2 |
Synonyms | HSD17; SDR9C2; EDH17B2 |
Gene ID | 3294 |
mRNA Refseq | NM_002153.3 |
Protein Refseq | NP_002144.1 |
MIM | 109685 |
UniProt ID | P37059 |
◆ Recombinant Proteins | ||
HSD17B2-2258H | Recombinant Human HSD17B2 Protein, His-tagged | +Inquiry |
RFL23332HF | Recombinant Full Length Human 17-Beta-Hydroxysteroid Dehydrogenase Type 2(Hsd17B2) Protein, His-Tagged | +Inquiry |
HSD17B2-206H | Recombinant Human HSD17B2, GST-tagged | +Inquiry |
HSD17B2-99HFL | Recombinant Full Length Human HSD17B2 Protein, C-Flag-tagged | +Inquiry |
HSD17B2-3728Z | Recombinant Zebrafish HSD17B2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B2-5375HCL | Recombinant Human HSD17B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B2 Products
Required fields are marked with *
My Review for All HSD17B2 Products
Required fields are marked with *
0
Inquiry Basket