Recombinant Full Length Human HSD17B14 Protein, GST-tagged
Cat.No. : | HSD17B14-3856HF |
Product Overview : | Human HSD17B14 full-length ORF ( NP_057330.2, 1 a.a. - 270 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 270 amino acids |
Description : | 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al., 2007 [PubMed 17067289]).[supplied by OMIM |
Molecular Mass : | 54.7 kDa |
AA Sequence : | MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HSD17B14 hydroxysteroid (17-beta) dehydrogenase 14 [ Homo sapiens ] |
Official Symbol | HSD17B14 |
Synonyms | HSD17B14; hydroxysteroid (17-beta) dehydrogenase 14; dehydrogenase/reductase (SDR family) member 10 , DHRS10; 17-beta-hydroxysteroid dehydrogenase 14; retinal short chain dehydrogenase/reductase 3; retSDR3; SDR47C1; short chain dehydrogenase/reductase family 47C; member 1; 17-beta-HSD 14; 17-beta-hydroxysteroid dehydrogenase DHRS10; dehydrogenase/reductase SDR family member 10; retinal short-chain dehydrogenase/reductase 3; dehydrogenase/reductase (SDR family) member 10; retinal short-chain dehydrogenase/reductase retSDR3; short chain dehydrogenase/reductase family 47C, member 1; DHRS10; |
Gene ID | 51171 |
mRNA Refseq | NM_016246 |
Protein Refseq | NP_057330 |
MIM | 612832 |
UniProt ID | Q9BPX1 |
◆ Recombinant Proteins | ||
HSD17B14-3856HF | Recombinant Full Length Human HSD17B14 Protein, GST-tagged | +Inquiry |
HSD17B14-2130H | Recombinant Human HSD17B14 Protein, MYC/DDK-tagged | +Inquiry |
HSD17B14-28397TH | Recombinant Human HSD17B14, His-tagged | +Inquiry |
HSD17B14-2877H | Recombinant Human HSD17B14, His-tagged | +Inquiry |
HSD17B14-1103H | Recombinant Human HSD17B14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B14-470HCL | Recombinant Human HSD17B14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B14 Products
Required fields are marked with *
My Review for All HSD17B14 Products
Required fields are marked with *
0
Inquiry Basket