Recombinant Human HSD17B14, His-tagged
Cat.No. : | HSD17B14-28397TH |
Product Overview : | Recombinant full length Human HSD17B14 protein with an N terminal His tag ; Predicted MWt: 32.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 270 amino acids |
Description : | 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al. |
Conjugation : | HIS |
Molecular Weight : | 32.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS |
Gene Name | HSD17B14 hydroxysteroid (17-beta) dehydrogenase 14 [ Homo sapiens ] |
Official Symbol | HSD17B14 |
Synonyms | HSD17B14; hydroxysteroid (17-beta) dehydrogenase 14; dehydrogenase/reductase (SDR family) member 10 , DHRS10; 17-beta-hydroxysteroid dehydrogenase 14; retinal short chain dehydrogenase/reductase 3; retSDR3; SDR47C1; short chain dehydrogenase/reductase fam |
Gene ID | 51171 |
mRNA Refseq | NM_016246 |
Protein Refseq | NP_057330 |
MIM | 612832 |
Uniprot ID | Q9BPX1 |
Chromosome Location | 19q13.33 |
Function | estradiol 17-beta-dehydrogenase activity; nucleotide binding; oxidoreductase activity; protein binding; testosterone 17-beta-dehydrogenase (NADP+) activity; |
◆ Recombinant Proteins | ||
HSD17B14-1103H | Recombinant Human HSD17B14 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD17B14-3615H | Recombinant Human HSD17B14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSD17B14-2130H | Recombinant Human HSD17B14 Protein, MYC/DDK-tagged | +Inquiry |
HSD17B14-960Z | Recombinant Zebrafish HSD17B14 | +Inquiry |
HSD17B14-2877H | Recombinant Human HSD17B14, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD17B14-470HCL | Recombinant Human HSD17B14 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HSD17B14 Products
Required fields are marked with *
My Review for All HSD17B14 Products
Required fields are marked with *
0
Inquiry Basket