Recombinant Human HSD17B14, His-tagged

• Cat.No.: HSD17B14-28397TH
• Product Overview: Recombinant full length Human HSD17B14 protein with an N terminal His tag ; Predicted MWt: 32.4 kDa.

Specification

• Description: 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics (Lukacik et al.
• Protein length: 270 amino acids
• Conjugation: HIS
• Molecular Weight: 32.400kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS

Gene Information

• Gene Name: HSD17B14 hydroxysteroid (17-beta) dehydrogenase 14 [ Homo sapiens ]
• Official Symbol: HSD17B14
• Synonyms: HSD17B14; hydroxysteroid (17-beta) dehydrogenase 14; dehydrogenase/reductase (SDR family) member 10 , DHRS10; 17-beta-hydroxysteroid dehydrogenase 14; retinal short chain dehydrogenase/reductase 3; retSDR3; SDR47C1; short chain dehydrogenase/reductase fam
• Gene ID: 51171
• mRNA Refseq: NM_016246
• Protein Refseq: NP_057330
• MIM: 612832
• Uniprot ID: Q9BPX1
• Chromosome Location: 19q13.33
• Function: estradiol 17-beta-dehydrogenase activity; nucleotide binding; oxidoreductase activity; protein binding; testosterone 17-beta-dehydrogenase (NADP+) activity