Recombinant Full Length Human HPCA Protein, GST-tagged

• Cat.No.: HPCA-3617HF
• Product Overview: Human HPCA full-length ORF ( NP_002134, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 193 amino acids
• Description: The protein encoded by this gene is a member of neuron-specific calcium-binding proteins family found in the retina and brain. This protein is associated with the plasma membrane. It has similarities to proteins located in the photoreceptor cells that regulate photosignal transduction in a calcium-sensitive manner. This protein displays recoverin activity and a calcium-dependent inhibition of rhodopsin kinase. It is identical to the rat and mouse hippocalcin proteins and thought to play an important role in neurons of the central nervous system in a number of species. [provided by RefSeq
• Molecular Mass: 46.86 kDa
• AA Sequence: MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSPGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSRSQF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HPCA hippocalcin [ Homo sapiens ]
• Official Symbol: HPCA
• Synonyms: HPCA; hippocalcin; neuron-specific calcium-binding protein hippocalcin; calcium-binding protein BDR-2; neuron specific calcium-binding protein hippocalcin; BDR2
• Gene ID: 3208
• mRNA Refseq: NM_002143
• Protein Refseq: NP_002134
• MIM: 142622
• UniProt ID: P84074