Recombinant Human HPCA protein(2-193aa), His&Myc-tagged

• Cat.No.: HPCA-329H
• Product Overview: Recombinant Human HPCA protein(P84074)(2-193aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 2-193aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: GKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGDASKFAEHVFRTFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIVRLLQCDPSSASQF

Gene Information

• Gene Name: HPCA hippocalcin [ Homo sapiens ]
• Official Symbol: HPCA
• Synonyms: HPCA; hippocalcin; neuron-specific calcium-binding protein hippocalcin; calcium-binding protein BDR-2; neuron specific calcium-binding protein hippocalcin; BDR2
• Gene ID: 3208
• mRNA Refseq: NM_002143
• Protein Refseq: NP_002134
• MIM: 142622
• UniProt ID: P84074