Recombinant Full Length Human HOXB6 Protein, GST-tagged

• Cat.No.: HOXB6-3719HF
• Product Overview: Human HOXB6 full-length ORF ( AAH14651, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 224 amino acids
• Description: This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer. [provided by RefSeq
• Molecular Mass: 50.27 kDa
• AA Sequence: MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HOXB6 homeobox B6 [ Homo sapiens ]
• Official Symbol: HOXB6
• Synonyms: HOXB6; homeobox B6; homeo box B6 , HOX2, HOX2B; homeobox protein Hox-B6; homeo box 2B; homeo box B6; homeobox protein Hu-2; homeobox protein Hox-2B; homeobox protein Hox-2.2; HOX2; HU-2; HOX2B; Hox-2.2
• Gene ID: 3216
• mRNA Refseq: NM_018952
• Protein Refseq: NP_061825
• MIM: 142961
• UniProt ID: P17509