Recombinant Human HOXB6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HOXB6-6295H
• Product Overview: HOXB6 MS Standard C13 and N15-labeled recombinant protein (NP_061825) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in development, including that of lung and skin, and has been localized to both the nucleus and cytoplasm. Altered expression of this gene or a change in the subcellular localization of its protein is associated with some cases of acute myeloid leukemia and colorectal cancer.
• Molecular Mass: 25.4 kDa
• AA Sequence: MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFHPEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKQAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HOXB6 homeobox B6 [ Homo sapiens (human) ]
• Official Symbol: HOXB6
• Synonyms: HOXB6; homeobox B6; homeo box B6, HOX2, HOX2B; homeobox protein Hox-B6; homeo box 2B; homeo box B6; homeobox protein Hu-2; homeobox protein Hox-2B; homeobox protein Hox-2.2; HOX2; HU-2; HOX2B; Hox-2.2
• Gene ID: 3216
• mRNA Refseq: NM_018952
• Protein Refseq: NP_061825
• MIM: 142961
• UniProt ID: P17509