Recombinant Full Length Human HORMAD2 Protein, GST-tagged

• Cat.No.: HORMAD2-3703HF
• Product Overview: Human HORMAD2 full-length ORF ( NP_689723.1, 1 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HORMAD2 (HORMA Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is HORMAD1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 61.7 kDa
• Protein length: 307 amino acids
• AA Sequence: MATAQLSHCITIHKASKETVFPSQITNEHESLKMVKKLFATSISCITYLRGLFPESSYGERHLDDLSLKILREDKKCPGSLHIIRWIQGCFDALEKRYLRMAVLTLYTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKASVLLIRKLYILMQDLEPLPNNVVLTMKLHYYNAVTPHDYQPLGFKEGVNSHFLLFDKEPINVQVGFVSTGFHSMKVKVMTEATKVIDLENNLFRENSTTEIAHQGLDCDEEEECNDHIQRMNFVCSQQSSECSRKKRKVSEPVKVFIPNRK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HORMAD2 HORMA domain containing 2 [ Homo sapiens ]
• Official Symbol: HORMAD2
• Synonyms: HORMAD2; HORMA domain containing 2; HORMA domain-containing protein 2; MGC26710
• Gene ID: 150280
• mRNA Refseq: NM_152510
• Protein Refseq: NP_689723
• MIM: 618842
• UniProt ID: Q8N7B1