Recombinant Full Length Human Hla Class Ii Histocompatibility Antigen, Dq Alpha 2 Chain(Hla-Dqa2) Protein, His-Tagged
Cat.No. : | RFL35265HF |
Product Overview : | Recombinant Full Length Human HLA class II histocompatibility antigen, DQ alpha 2 chain(HLA-DQA2) Protein (P01906) (24-255aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (24-255) |
Form : | Lyophilized powder |
AA Sequence : | EDIVADHVASYGVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSKFPVTLGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPEIPAPMSELTETLVCALGLSVGLMGIVVGTVFIIQGLRSVGASRHQGLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HLA-DQA2 |
Synonyms | DQ(6) alpha chain; DQA2_HUMAN; DX alpha; DX alpha chain; HLA class II histocompatibility antigen; HLA class II histocompatibility antigen DQ(6) alpha chain; HLA class II histocompatibility antigen; DQ alpha 2 chain; HLA DXA; HLA-DQA1; HLA-DQA2; Major hist |
UniProt ID | P01906 |
◆ Recombinant Proteins | ||
RFL35265HF | Recombinant Full Length Human Hla Class Ii Histocompatibility Antigen, Dq Alpha 2 Chain(Hla-Dqa2) Protein, His-Tagged | +Inquiry |
HLA-DQA2-1279H | Recombinant Human HLA-DQA2 Protein (24-214 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DQA2-5494HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLA-DQA2 Products
Required fields are marked with *
My Review for All HLA-DQA2 Products
Required fields are marked with *
0
Inquiry Basket