Recombinant Full Length Human Histamine H3 Receptor(Hrh3) Protein, His-Tagged
Cat.No. : | RFL32445HF |
Product Overview : | Recombinant Full Length Human Histamine H3 receptor(HRH3) Protein (Q9Y5N1) (1-445aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-445) |
Form : | Lyophilized powder |
AA Sequence : | MERAPPDGPLNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCTS SAFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMLLVWVLAFLLYGPAILSWEYLSGG SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGAREAA GPEPPPEAQPSPPPPPGCWGCWQKGHGEAMPLHRYGVGEAAVGAEAGEATLGGGGGGGSV ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSFTQRFRLSRDRKVAKSL AVIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHHSFR RAFTKLLCPQKLKIQPHSSLEHCWK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HRH3 |
Synonyms | HRH3; GPCR97; Histamine H3 receptor; H3R; HH3R; G-protein coupled receptor 97 |
UniProt ID | Q9Y5N1 |
◆ Recombinant Proteins | ||
RFL31628HF | Recombinant Full Length Human B-Lymphocyte Antigen Cd20(Ms4A1) Protein, His-Tagged | +Inquiry |
ESR2-12558H | Recombinant Human ESR2, GST-tagged | +Inquiry |
Core-1664H | Recombinant HCV/Genotype-6a Core Protein, His-tagged | +Inquiry |
RFL25293KF | Recombinant Full Length Klebsiella Pneumoniae Universal Stress Protein B(Uspb) Protein, His-Tagged | +Inquiry |
RBP2-30008TH | Recombinant Human RBP2 | +Inquiry |
◆ Native Proteins | ||
IgG-217H | Native Human Immunoglobulin G (IgG) | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
S100A9-3179H | Native Human S100A9 protein(Met1-Pro114) | +Inquiry |
C-type lectin like protein-040H | Native Hen C-type lectin like protein Protein | +Inquiry |
IgM-235H | Native Human Immunoglobulin M (IgM) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKRD29-8852HCL | Recombinant Human ANKRD29 293 Cell Lysate | +Inquiry |
NRG3-3697HCL | Recombinant Human NRG3 293 Cell Lysate | +Inquiry |
BMP1-8436HCL | Recombinant Human BMP1 293 Cell Lysate | +Inquiry |
RAB41-2591HCL | Recombinant Human RAB41 293 Cell Lysate | +Inquiry |
NICN1-3830HCL | Recombinant Human NICN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HRH3 Products
Required fields are marked with *
My Review for All HRH3 Products
Required fields are marked with *
0
Inquiry Basket