Recombinant Full Length Human HIST3H3 Protein, GST-tagged

• Cat.No.: HIST3H3-3606HF
• Product Overview: Human HIST3H3 full-length ORF (BAG35150.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 136 amino acids
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq
• Molecular Mass: 41.36 kDa
• AA Sequence: MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST3H3 histone cluster 3, H3 [ Homo sapiens ]
• Official Symbol: HIST3H3
• Synonyms: HIST3H3; histone cluster 3, H3; H3 histone family, member T , H3FT, histone 3, H3; histone H3.1t; H3/g; H3t; H3/t; histone 3, H3; H3 histone family, member T; H3.4; H3FT; MGC126886; MGC126888
• Gene ID: 8290
• mRNA Refseq: NM_003493
• Protein Refseq: NP_003484
• MIM: 602820
• UniProt ID: Q16695