Recombinant Full Length Human HIST1H2BA Protein, GST-tagged

• Cat.No.: HIST1H2BA-3575HF
• Product Overview: Human HIST1H2BA full-length ORF (BAG34991.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a testis/sperm-specific member of the histone H2B family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 40.37 kDa
• Protein length: 127 amino acids
• AA Sequence: MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST1H2BA histone cluster 1, H2ba [ Homo sapiens ]
• Official Symbol: HIST1H2BA
• Synonyms: HIST1H2BA; histone cluster 1, H2ba; H2B histone family, member U, (testis specific) , histone 1, H2ba; histone H2B type 1-A; bA317E16.3; H2BFU; STBP; TSH2B; histone 1, H2ba; histone H2B, testis; testis-specific histone H2B; H2B histone family, member U, (testis-specific)
• Gene ID: 255626
• mRNA Refseq: NM_170610
• Protein Refseq: NP_733759
• MIM: 609904
• UniProt ID: Q96A08