Recombinant Full Length Human Herpesvirus 1 Envelope Protein Us9 (Us9) Protein, His-Tagged
Cat.No. : | RFL9811HF |
Product Overview : | Recombinant Full Length Human herpesvirus 1 Envelope protein US9 (US9) Protein (P06481) (1-90aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Herpesvirus 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-90) |
Form : | Lyophilized powder |
AA Sequence : | MTSRLSDPNSSARSDMSVPLYPTASPVSVEAYYSESEDEAANDFLVRMGRQQSVLRRRRR RTRCVGMVIACLLVAVLSGGFGALLMWLLR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | US9 |
Synonyms | US9; Envelope protein US9; 10 kDa protein |
UniProt ID | P06481 |
◆ Native Proteins | ||
Protein C-89H | Native Human Protein C | +Inquiry |
Trf-70M | Native Mouse Apotransferrin | +Inquiry |
Lectin-1832R | Active Native Ricinus Communis Agglutinin I Protein, Fluorescein labeled | +Inquiry |
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDGFRB-1046CCL | Recombinant Cynomolgus PDGFRB cell lysate | +Inquiry |
EPB49-565HCL | Recombinant Human EPB49 cell lysate | +Inquiry |
BLK-614HCL | Recombinant Human BLK cell lysate | +Inquiry |
FAM110A-6455HCL | Recombinant Human FAM110A 293 Cell Lysate | +Inquiry |
CYP26A1-7121HCL | Recombinant Human CYP26A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All US9 Products
Required fields are marked with *
My Review for All US9 Products
Required fields are marked with *
0
Inquiry Basket