Recombinant Full Length Candida Glabrata C-5 Sterol Desaturase(Erg3) Protein, His-Tagged
Cat.No. : | RFL7380CF |
Product Overview : | Recombinant Full Length Candida glabrata C-5 sterol desaturase(ERG3) Protein (P50860) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida Glabrata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MDLVLETLDHYIFDDVYAKIAPVELQRGIDDSLVNALSLNKIVSNSTLLHETLSITNSLK RVNKDVYGLTPFLFDFTEKTYASLLPRNNLIREFFSLWAVVTVFGLLLYLITASLSYVFV FDRTIFNHPKYLKNQMYLEIKLAVSAIPTMSLLTVPWFMLELNGYSKLYYDVDWEHHGLR KLLIEYATFIFFTDCGIYLAHRWLHWPRVYKALHKPHHKWLVCTPFASHAFHPVDGYFQS LSYHIYPMILPLHKISYLILFTFVNFWSVMIHDGQHMSNNPVVNGTACHTVHHLYFNYNY GQFTTLWDRLGGSYRRPEDSLFDPKLKMDKKVLEKQARETAAYIQEVEGDDTDRVYNTDK KKTN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ERG3 |
Synonyms | ERG3; CAGL0F01793g; Delta(7-sterol 5(6-desaturase; C-5 sterol desaturase; Ergosterol Delta(5,6 desaturase; Sterol-C5-desaturase |
UniProt ID | P50860 |
◆ Recombinant Proteins | ||
CABS1-2578H | Recombinant Human CABS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DMPK-2211H | Recombinant Human DMPK Protein, MYC/DDK-tagged | +Inquiry |
PLEKHA8-4514R | Recombinant Rat PLEKHA8 Protein | +Inquiry |
SZRD1-16348M | Recombinant Mouse SZRD1 Protein | +Inquiry |
NMRK1-2140Z | Recombinant Zebrafish NMRK1 | +Inquiry |
◆ Native Proteins | ||
Lectin-1786G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein | +Inquiry |
TroponinCIT-33HFL | Native Full Length Human Cardiac Troponin C-I-T Complex | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
Y. enterocolitica-29 | Native Yersinia enterocolitica O:3 Antigen | +Inquiry |
Collagen-121H | Native Human Collagen Type IV protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
THBS1-1101HCL | Recombinant Human THBS1 293 Cell Lysate | +Inquiry |
FGFR3-001CCL | Recombinant Cynomolgus FGFR3 cell lysate | +Inquiry |
STAT4-488HCL | Recombinant Human STAT4 cell lysate | +Inquiry |
PLAU-1734HCL | Recombinant Human PLAU cell lysate | +Inquiry |
NDUFS8-3892HCL | Recombinant Human NDUFS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ERG3 Products
Required fields are marked with *
My Review for All ERG3 Products
Required fields are marked with *
0
Inquiry Basket