Recombinant Full Length Human HDHD3 Protein, GST-tagged

• Cat.No.: HDHD3-3444HF
• Product Overview: Human HDHD3 full-length ORF ( NP_112496.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HDHD3 (Haloacid Dehalogenase Like Hydrolase Domain Containing 3) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 54.4 kDa
• Protein length: 251 amino acids
• AA Sequence: MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HDHD3 haloacid dehalogenase-like hydrolase domain containing 3 [ Homo sapiens ]
• Official Symbol: HDHD3
• Synonyms: HDHD3; haloacid dehalogenase-like hydrolase domain containing 3; C9orf158, chromosome 9 open reading frame 158; haloacid dehalogenase-like hydrolase domain-containing protein 3; MGC12904; C9orf158; 2810435D12Rik
• Gene ID: 81932
• mRNA Refseq: NM_031219
• Protein Refseq: NP_112496
• UniProt ID: Q9BSH5