Recombinant Human HDHD3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HDHD3-4839H
• Product Overview: HDHD3 MS Standard C13 and N15-labeled recombinant protein (NP_112496) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Belongs to the HAD-like hydrolase superfamily.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 28 kDa
• AA Sequence: MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HDHD3 haloacid dehalogenase-like hydrolase domain containing 3 [ Homo sapiens (human) ]
• Official Symbol: HDHD3
• Synonyms: HDHD3; haloacid dehalogenase-like hydrolase domain containing 3; C9orf158, chromosome 9 open reading frame 158; haloacid dehalogenase-like hydrolase domain-containing protein 3; MGC12904; C9orf158; 2810435D12Rik
• Gene ID: 81932
• mRNA Refseq: NM_031219
• Protein Refseq: NP_112496
• UniProt ID: Q9BSH5