Recombinant Full Length Human HBG2 Protein, GST-tagged

• Cat.No.: HBG2-3495HF
• Product Overview: Human HBG2 full-length ORF (AAH10914.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5- epsilon -- gamma-G -- gamma-A -- delta -- beta--3. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.57 kDa
• Protein length: 147 amino acids
• AA Sequence: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HBG2 hemoglobin subunit gamma 2 [ Homo sapiens (human) ]
• Official Symbol: HBG2
• Synonyms: HBG2; hemoglobin subunit gamma 2; TNCY; HBG-T1; hemoglobin subunit gamma-2; G-gamma globin Paulinia; abnormal hemoglobin; gamma-2-globin; hb F Ggamma; hemoglobin gamma-2 chain; hemoglobin gamma-G chain; hemoglobin, gamma G; methemoglobin
• Gene ID: 3048
• mRNA Refseq: NM_000184
• Protein Refseq: NP_000175
• MIM: 142250
• UniProt ID: P69892