Recombinant Full Length Human HBG2 Protein, GST-tagged

Cat.No. : HBG2-3495HF
Product Overview : Human HBG2 full-length ORF (AAH10914.1, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 147 amino acids
Description : The gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5- epsilon -- gamma-G -- gamma-A -- delta -- beta--3. [provided by RefSeq
Molecular Mass : 42.57 kDa
AA Sequence : MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HBG2 hemoglobin subunit gamma 2 [ Homo sapiens (human) ]
Official Symbol HBG2
Synonyms HBG2; hemoglobin subunit gamma 2; TNCY; HBG-T1; hemoglobin subunit gamma-2; G-gamma globin Paulinia; abnormal hemoglobin; gamma-2-globin; hb F Ggamma; hemoglobin gamma-2 chain; hemoglobin gamma-G chain; hemoglobin, gamma G; methemoglobin
Gene ID 3048
mRNA Refseq NM_000184
Protein Refseq NP_000175
MIM 142250
UniProt ID P69892

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HBG2 Products

Required fields are marked with *

My Review for All HBG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon