Recombinant Full Length Human HAAO Protein, C-Flag-tagged
Cat.No. : | HAAO-643HFL |
Product Overview : | Recombinant Full Length Human HAAO Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | 3-Hydroxyanthranilate 3,4-dioxygenase is a monomeric cytosolic protein belonging to the family of intramolecular dioxygenases containing nonheme ferrous iron. It is widely distributed in peripheral organs, such as liver and kidney, and is also present in low amounts in the central nervous system. HAAO catalyzes the synthesis of quinolinic acid (QUIN) from 3-hydroxyanthranilic acid. QUIN is an excitotoxin whose toxicity is mediated by its ability to activate glutamate N-methyl-D-aspartate receptors. Increased cerebral levels of QUIN may participate in the pathogenesis of neurologic and inflammatory disorders. HAAO has been suggested to play a role in disorders associated with altered tissue levels of QUIN. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | MERRLGVRAWVKENRGSFQPPVCNKLMHQEQLKVMFIGGPNTRKDYHIEEGEEVFYQLEGDMVLRVLEQG KHRDVVIRQGEIFLLPARVPHSPQRFANTVGLVVERRRLETELDGLRYYVGDTMDVLFEKWFYCKDLGTQ LAPIIQEFFSSEQYRTGKPIPDQLLKEPPFPLSTRSIMEPMSLDAWLDSHHRELQAGTPLSLFGDTYETQ VIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDPA CKKPLGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Metabolic pathways, Tryptophan metabolism |
Full Length : | Full L. |
Gene Name | HAAO 3-hydroxyanthranilate 3,4-dioxygenase [ Homo sapiens (human) ] |
Official Symbol | HAAO |
Synonyms | HAO; 3-HAO; VCRL1; h3HAO |
Gene ID | 23498 |
mRNA Refseq | NM_012205.3 |
Protein Refseq | NP_036337.2 |
MIM | 604521 |
UniProt ID | P46952 |
◆ Recombinant Proteins | ||
Haao-346M | Recombinant Mouse Haao Protein, MYC/DDK-tagged | +Inquiry |
HAAO-643HFL | Recombinant Full Length Human HAAO Protein, C-Flag-tagged | +Inquiry |
HAAO-2778R | Recombinant Rat HAAO Protein | +Inquiry |
HAAO-5306H | Recombinant Human HAAO Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HAAO-4547H | Recombinant Human HAAO Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAAO-5650HCL | Recombinant Human HAAO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAAO Products
Required fields are marked with *
My Review for All HAAO Products
Required fields are marked with *
0
Inquiry Basket