Recombinant Full Length Human GZMK Protein, GST-tagged

Cat.No. : GZMK-3391HF
Product Overview : Human GZMK full-length ORF ( NP_002095.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 264 amino acids
Description : This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. [provided by RefSeq
Molecular Mass : 55.3 kDa
AA Sequence : MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GZMK granzyme K (granzyme 3; tryptase II) [ Homo sapiens ]
Official Symbol GZMK
Synonyms GZMK; granzyme K (granzyme 3; tryptase II); granzyme K (serine protease, granzyme 3; tryptase II); granzyme K; PRSS; TRYP2; NK-Tryp-2; granzyme 3; granzyme-3; tryptase II; fragmentin-3; NK-tryptase-2; granzyme K (serine protease, granzyme 3; tryptase II);
Gene ID 3003
mRNA Refseq NM_002104
Protein Refseq NP_002095
MIM 600784
UniProt ID P49863

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GZMK Products

Required fields are marked with *

My Review for All GZMK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon