Recombinant Full Length Human GZMK Protein
Cat.No. : | GZMK-220HF |
Product Overview : | Recombinant full length Human Granzyme K (amino acids 1-264) with N terminal proprietary tag; predicted MW 55.11 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 264 amino acids |
Description : | This gene product is a member of a group of related serine proteases from the cytoplasmic granules of cytotoxic lymphocytes. Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here lacks consensus sequences for N-glycosylation present in other granzymes. |
Form : | Liquid |
Molecular Mass : | 55.110kDa inclusive of tags |
AA Sequence : | MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPF MASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTV VLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLV KLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPD SLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCA GDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKP GIYTLLTKKYQTWIKSNLVPPHTN |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GZMK granzyme K (granzyme 3; tryptase II) [ Homo sapiens ] |
Official Symbol | GZMK |
Synonyms | GZMK; granzyme K (granzyme 3; tryptase II); granzyme K (serine protease, granzyme 3; tryptase II); granzyme K; PRSS; TRYP2 |
Gene ID | 3003 |
mRNA Refseq | NM_002104 |
Protein Refseq | NP_002095 |
MIM | 600784 |
UniProt ID | P49863 |
◆ Recombinant Proteins | ||
Gzmk-3533M | Recombinant Mouse Gzmk protein, His-tagged | +Inquiry |
GZMK-140H | Recombinant Human GZMK protein, His-tagged | +Inquiry |
GZMK-4524H | Recombinant Human GZMK Protein, GST-tagged | +Inquiry |
GZMK-2426R | Recombinant Rat GZMK Protein, His (Fc)-Avi-tagged | +Inquiry |
GZMK-3391HF | Recombinant Full Length Human GZMK Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GZMK-5667HCL | Recombinant Human GZMK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GZMK Products
Required fields are marked with *
My Review for All GZMK Products
Required fields are marked with *
0
Inquiry Basket