Recombinant Full Length Human GRN Protein, C-Flag-tagged
Cat.No. : | GRN-844HFL |
Product Overview : | Recombinant Full Length Human GRN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Granulins are a family of secreted, glycosylated peptides that are cleaved from a single precursor protein with 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif. The 88 kDa precursor protein, progranulin, is also called proepithelin and PC cell-derived growth factor. Cleavage of the signal peptide produces mature granulin which can be further cleaved into a variety of active, 6 kDa peptides. These smaller cleavage products are named granulin A, granulin B, granulin C, etc. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. Both the peptides and intact granulin protein regulate cell growth. However, different members of the granulin protein family may act as inhibitors, stimulators, or have dual actions on cell growth. Granulin family members are important in normal development, wound healing, and tumorigenesis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 61.7 kDa |
AA Sequence : | MWTLVSWVALTAGLVAGTRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAG HSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCC VMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPD ARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVG DVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPA HLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGS EIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNV KARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCP AGFRCAARGTKCLRREAPRWDAPLRDPALRQLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | GRN granulin precursor [ Homo sapiens (human) ] |
Official Symbol | GRN |
Synonyms | GEP; GP88; PEPI; PGRN; CLN11; PCDGF |
Gene ID | 2896 |
mRNA Refseq | NM_002087.4 |
Protein Refseq | NP_002078.1 |
MIM | 138945 |
UniProt ID | P28799 |
◆ Recombinant Proteins | ||
Grn-466M | Active Recombinant Mouse Grn, FLAG-tagged | +Inquiry |
GRN-4937H | Recombinant Human Mitogen-Activated Protein Kinase 11 | +Inquiry |
GRN-1022H | Recombinant Human GRN Protein, His (Fc)-Avi-tagged | +Inquiry |
Grn-1065M | Recombinant Mouse Grn Protein, MYC/DDK-tagged | +Inquiry |
GRN-2709H | Recombinant Human GRN protein(491-570 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRN-2791HCL | Recombinant Human GRN cell lysate | +Inquiry |
GRN-2412MCL | Recombinant Mouse GRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRN Products
Required fields are marked with *
My Review for All GRN Products
Required fields are marked with *
0
Inquiry Basket