Recombinant Human GRN protein(491-570 aa), C-His-tagged

Cat.No. : GRN-2709H
Product Overview : Recombinant Human GRN protein(P28799)(491-570 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 491-570 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : KARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGT
Gene Name GRN granulin [ Homo sapiens ]
Official Symbol GRN
Synonyms GRN; granulin; granulins; CLN11; PCDGF; PGRN; progranulin; acrogranin; proepithelin; granulin-epithelin; PC cell-derived growth factor; GEP; GP88; PEPI;
Gene ID 2896
mRNA Refseq NM_002087
Protein Refseq NP_002078
MIM 138945
UniProt ID P28799

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRN Products

Required fields are marked with *

My Review for All GRN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon