Recombinant Full Length Human GRIA3 Protein, GST-tagged

Cat.No. : GRIA3-5622HF
Product Overview : Human GRIA3 full-length ORF ( NP_871623.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 144 amino acids
Description : Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing at this locus results in different isoforms, which may vary in their signal transduction properties. [provided by RefSeq
Molecular Mass : 42.5 kDa
AA Sequence : MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNACPAERDYLPWPGSIRENNWTALPCCKDHGLLHLKCSPGGARQNWAYCIWGVTGEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRIA3 glutamate receptor, ionotropic, AMPA 3 [ Homo sapiens ]
Official Symbol GRIA3
Synonyms GRIA3; glutamate receptor, ionotropic, AMPA 3; GLUR3, glutamate receptor, ionotrophic, AMPA 3; glutamate receptor 3; GluA3; GLURC; MRX94; gluR-3; dJ1171F9.1; glutamate receptor C; glutamate receptor subunit 3; AMPA-selective glutamate receptor 3; glutamate receptor, ionotrophic, AMPA 3; GLUR3; GLUR-C; GLUR-K3;
Gene ID 2892
mRNA Refseq NM_000828
Protein Refseq NP_000819
MIM 305915
UniProt ID P42263

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRIA3 Products

Required fields are marked with *

My Review for All GRIA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon