Recombinant Full Length Human GRIA3 Protein, GST-tagged

• Cat.No.: GRIA3-5622HF
• Product Overview: Human GRIA3 full-length ORF ( NP_871623.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing at this locus results in different isoforms, which may vary in their signal transduction properties. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.5 kDa
• Protein length: 144 amino acids
• AA Sequence: MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNACPAERDYLPWPGSIRENNWTALPCCKDHGLLHLKCSPGGARQNWAYCIWGVTGEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRIA3 glutamate receptor, ionotropic, AMPA 3 [ Homo sapiens ]
• Official Symbol: GRIA3
• Synonyms: GRIA3; glutamate receptor, ionotropic, AMPA 3; GLUR3, glutamate receptor, ionotrophic, AMPA 3; glutamate receptor 3; GluA3; GLURC; MRX94; gluR-3; dJ1171F9.1; glutamate receptor C; glutamate receptor subunit 3; AMPA-selective glutamate receptor 3; glutamate receptor, ionotrophic, AMPA 3; GLUR3; GLUR-C; GLUR-K3
• Gene ID: 2892
• mRNA Refseq: NM_000828
• Protein Refseq: NP_000819
• MIM: 305915
• UniProt ID: P42263