Recombinant Full Length Human GREM2 Protein, GST-tagged

• Cat.No.: GREM2-5608HF
• Product Overview: Human GREM2 full-length ORF ( AAH46632.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 168 amino acids
• Description: This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. [provided by RefSeq
• Molecular Mass: 44.22 kDa
• AA Sequence: MFWKLSLSLFMVAVLVKVAEARKNRPAGAIHSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCCGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GREM2 gremlin 2 [ Homo sapiens ]
• Official Symbol: GREM2
• Synonyms: GREM2; gremlin 2; gremlin 2, cysteine knot superfamily, homolog (Xenopus laevis); gremlin-2; CKTSF1B2; DAND3; FLJ21195; Prdc; protein related to DAN and cerberus; DAN domain family member 3; cysteine knot superfamily 1, BMP antagonist 2; gremlin 2, cysteine knot superfamily, homolog; PRDC
• Gene ID: 64388
• mRNA Refseq: NM_022469
• Protein Refseq: NP_071914
• MIM: 608832
• UniProt ID: Q9H772