Recombinant Full Length Human GPRC5A Protein, C-Flag-tagged
Cat.No. : | GPRC5A-751HFL |
Product Overview : | Recombinant Full Length Human GPRC5A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the type 3 G protein-coupling receptor family, characterized by the signature 7-transmembrane domain motif. The encoded protein may be involved in interaction between retinoid acid and G protein signalling pathways. Retinoic acid plays a critical role in development, cellular growth, and differentiation. This gene may play a role in embryonic development and epithelial cell differentiation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.1 kDa |
AA Sequence : | MATTVPDGCRNGLKSKYYRLCDKAEAWGIVLETVATAGVVTSVAFMLTLPILVCKVQDSNRRKMLPTQFL FLLGVLGIFGLTFAFIIGLDGSTGPTRFFLFGILFSICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVG FSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHG AHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVE DAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY EVKKEGSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, GPCR, Transmembrane |
Full Length : | Full L. |
Gene Name | GPRC5A G protein-coupled receptor class C group 5 member A [ Homo sapiens (human) ] |
Official Symbol | GPRC5A |
Synonyms | RAI3; TIG1; RAIG1; GPCR5A; PEIG-1 |
Gene ID | 9052 |
mRNA Refseq | NM_003979.4 |
Protein Refseq | NP_003970.1 |
MIM | 604138 |
UniProt ID | Q8NFJ5 |
◆ Recombinant Proteins | ||
GPRC5A-751HFL | Recombinant Full Length Human GPRC5A Protein, C-Flag-tagged | +Inquiry |
GPRC5A-1339H | Recombinant Human GPRC5A protein, GST-tagged | +Inquiry |
RFL32696HF | Recombinant Full Length Human Retinoic Acid-Induced Protein 3(Gprc5A) Protein, His-Tagged | +Inquiry |
GPRC5A-3215H | Recombinant Human GPRC5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GPRC5A-5534HF | Recombinant Full Length Human GPRC5A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPRC5A-5771HCL | Recombinant Human GPRC5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPRC5A Products
Required fields are marked with *
My Review for All GPRC5A Products
Required fields are marked with *
0
Inquiry Basket