Recombinant Full Length Human GPR12 Protein, GST-tagged

Cat.No. : GPR12-5614HF
Product Overview : Human GPR12 full-length ORF ( NP_005279.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 334 amino acids
Description : GPR12 (G Protein-Coupled Receptor 12) is a Protein Coding gene. Among its related pathways are Peptide ligand-binding receptors. GO annotations related to this gene include G-protein coupled receptor activity and phosphatidylcholine binding. An important paralog of this gene is GPR6.
Molecular Mass : 63.1 kDa
AA Sequence : MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPR12 G protein-coupled receptor 12 [ Homo sapiens ]
Official Symbol GPR12
Synonyms GPR12; G protein-coupled receptor 12; G-protein coupled receptor 12; GPCR21; GPCR12; FLJ18149; FLJ97704; MGC138349; MGC138351;
Gene ID 2835
mRNA Refseq NM_005288
Protein Refseq NP_005279
MIM 600752
UniProt ID P47775

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GPR12 Products

Required fields are marked with *

My Review for All GPR12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon