Recombinant Human GPR12
Cat.No. : | GPR12-29093TH |
Product Overview : | Recombinant full length Human GPCR GPR12 with N terminal proprietary tag; Predicted MWt 62.81 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
ProteinLength : | 334 amino acids |
Molecular Weight : | 62.810kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEP ELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMF LLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVM LVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAA ILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPS IYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCI PSSLAQRARSPSDV |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name | GPR12 G protein-coupled receptor 12 [ Homo sapiens ] |
Official Symbol | GPR12 |
Synonyms | GPR12; G protein-coupled receptor 12; G-protein coupled receptor 12; GPCR21; |
Gene ID | 2835 |
mRNA Refseq | NM_005288 |
Protein Refseq | NP_005279 |
MIM | 600752 |
Uniprot ID | P47775 |
Chromosome Location | 13q12 |
Pathway | GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
Function | G-protein coupled receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
MCM4-1384H | Recombinant Human MCM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFRSF10A-112H | Recombinant Human TNFRSF10A | +Inquiry |
SSP-RS08340-0618S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS08340 protein, His-tagged | +Inquiry |
CDK10-CCNQ-01HFL | Recombinant Full Length Human CDK10 and CCNQ co-expressed Protein, N-GST-tagged | +Inquiry |
PMPCB-796C | Recombinant Cynomolgus PMPCB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1793A | Active Native Artocarpus integrifolia Jacalin Protein, Biotinylated | +Inquiry |
TTR-131H | Native Human Prealbumin protein | +Inquiry |
Lectin-1820P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Fluorescein labeled | +Inquiry |
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
Lectin-1798L | Active Native Lotus Tetragonolobus Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCI-H460-047WCY | Human Large Cell Lung Carcinoma NCI-H460 Whole Cell Lysate | +Inquiry |
Muscles-788D | Dog S. Muscles Membrane Lysate, Total Protein | +Inquiry |
RAB39A-1453HCL | Recombinant Human RAB39A cell lysate | +Inquiry |
ELOF1-6617HCL | Recombinant Human ELOF1 293 Cell Lysate | +Inquiry |
SHOC2-1852HCL | Recombinant Human SHOC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR12 Products
Required fields are marked with *
My Review for All GPR12 Products
Required fields are marked with *
0
Inquiry Basket