Recombinant Full Length Human GPR12 Protein
Cat.No. : | GPR12-202HF |
Product Overview : | Recombinant full length Human GPCR GPR12 with N terminal proprietary tag; Predicted MWt 62.81 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 334 amino acids |
Description : | Predicted to enable G protein-coupled receptor activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of metabolic process. Predicted to act upstream of or within G protein-coupled receptor signaling pathway and cellular calcium ion homeostasis. Predicted to be integral component of plasma membrane. Predicted to be active in cytoplasm and plasma membrane. |
Form : | Liquid |
Molecular Mass : | 62.810kDa inclusive of tags |
AA Sequence : | MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEP ELVVNPWDIVLCTSGTLISCENAIVVLIIFHNPSLRAPMF LLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVM LVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAA ILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPS IYTYATLLPATYNSIINPVIYAFRNQEIQKALCLICCGCI PSSLAQRARSPSDV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GPR12 G protein-coupled receptor 12 [ Homo sapiens ] |
Official Symbol | GPR12 |
Synonyms | GPR12; G protein-coupled receptor 12; G-protein coupled receptor 12; GPCR21 |
Gene ID | 2835 |
mRNA Refseq | NM_005288 |
Protein Refseq | NP_005279 |
MIM | 600752 |
UniProt ID | P47775 |
◆ Recombinant Proteins | ||
Cd69-5811R | Recombinant Rat Cd69 protein, His-tagged | +Inquiry |
TNFRSF13C-3992H | Recombinant Human TNFRSF13C Protein (Arg2-Ala71), C-Fc tagged | +Inquiry |
SLGD-RS03860-5221S | Recombinant Staphylococcus lugdunensis HKU09-01 SLGD_RS03860 protein, His-tagged | +Inquiry |
NLRP8-2870R | Recombinant Rhesus Macaque NLRP8 Protein, His (Fc)-Avi-tagged | +Inquiry |
STAT2-333H | Recombinant Human STAT2 protein, His/MBP-tagged | +Inquiry |
◆ Native Proteins | ||
C1QA-26126TH | Native Human C1QA | +Inquiry |
S100AA-258B | Native Bovine S-100αα Protein | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
IgG-329R | Native Rabbit Gamma Globulin Fraction | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
YAP1-250HCL | Recombinant Human YAP1 293 Cell Lysate | +Inquiry |
ZNF224-1997HCL | Recombinant Human ZNF224 cell lysate | +Inquiry |
KCNH1-5060HCL | Recombinant Human KCNH1 293 Cell Lysate | +Inquiry |
COA3-7759HCL | Recombinant Human CCDC56 293 Cell Lysate | +Inquiry |
Esophagus-462C | Cat Esophagus Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GPR12 Products
Required fields are marked with *
My Review for All GPR12 Products
Required fields are marked with *
0
Inquiry Basket