Recombinant Full Length Human GPIHBP1 Protein, GST-tagged

• Cat.No.: GPIHBP1-6942HF
• Product Overview: Recombinant Human full-length GPIHBP1(1 a.a. - 184 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 184 amino acids
• Description: Dietary fats are packaged by intestine into triglyceride-rich lipoproteins called chylomicrons. The triglycerides in chylomicrons are hydrolyzed by lipoprotein lipase (LPL: MIM 609708) along the luminal surface of capillaries, mainly in heart, skeletal muscle, and adipose tissue. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons.
• Molecular Mass: 46.2 kDa
• AA Sequence: MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDE RCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT GKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPIHBP1 glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: GPIHBP1
• Synonyms: GPIHBP1; GPI-HBP1; glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-anchored HDL-binding protein 1; high density lipoprotein-binding protein 1; GPI anchored high density lipoprotein binding protein 1
• Gene ID: 338328
• mRNA Refseq: NM_178172
• Protein Refseq: NP_835466
• MIM: 612757
• UniProt ID: Q8IV16