Recombinant Human GPIHBP1, His-tagged

• Cat.No.: GPIHBP1-95H
• Product Overview: Recombinant Human Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1/GPIHBP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln21-Ser160) of Human GPIHBP1 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 21-160 a.a.
• Description: Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1 (GPIHBP1) is a single-pass membrane protein that contains one UPAR/Ly6 domain. GPIHBP1 is localized to the cell surface. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons. GPIHBP1 plays a key role in the lipolytic processing of chylomicrons.
• AA Sequence: QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSH GQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT GKGAGGPRGSVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: GPIHBP1 glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [ Homo sapiens ]
• Official Symbol: GPIHBP1
• Synonyms: GPIHBP1; glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1; GPI anchored high density lipoprotein binding protein 1; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI HBP1; LOC338328; GPI-anchored HDL-binding protein 1; high density lipoprotein-binding protein 1; GPI-HBP1
• Gene ID: 338328
• mRNA Refseq: NM_178172
• Protein Refseq: NP_835466
• MIM: 612757
• UniProt ID: Q8IV16
• Chromosome Location: 8q24.3
• Function: apolipoprotein binding; chylomicron binding; high-density lipoprotein particle binding; lipase binding; lipid binding; lipoprotein particle binding; protein transmembrane transporter activity