Recombinant Human GNG7

• Cat.No.: GNG7-28961TH
• Product Overview: Recombinant full length Human G gamma7 with a N terminal proprietary tag; Predicted MW 33.59 kDa.

Specification

• Description: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 is a protein that in humans is encoded by the GNG7 gene.
• Protein length: 68 amino acids
• Molecular Weight: 33.590kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed in a variety of tissues. Down-regulated in pancreatic and esophageal cancer.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL
• Sequence Similarities: Belongs to the G protein gamma family.
• Tag: Non

Gene Information

• Gene Name: GNG7 guanine nucleotide binding protein (G protein), gamma 7 [ Homo sapiens ]
• Official Symbol: GNG7
• Synonyms: GNG7; guanine nucleotide binding protein (G protein), gamma 7; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7; FLJ00058
• Gene ID: 2788
• mRNA Refseq: NM_052847
• Protein Refseq: NP_443079
• MIM: 604430
• Uniprot ID: O60262
• Chromosome Location: 19p13.3
• Pathway: ADP signalling through P2Y purinoceptor 1, organism-specific biosystem; ADP signalling through P2Y purinoceptor 12, organism-specific biosystem; Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; Activation of Kainate Receptors upon glutamate binding, organism-specific biosystem
• Function: signal transducer activity