Recombinant Full Length Human GNG5 Protein, C-Flag-tagged

• Cat.No.: GNG5-1174HFL
• Product Overview: Recombinant Full Length Human GNG5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: G proteins are trimeric (alpha-beta-gamma) membrane-associated proteins that regulate flow of information from cell surface receptors to a variety of internal metabolic effectors. Interaction of a G protein with its activated receptor promotes exchange of GTP for GDP that is bound to the alpha subunit. The alpha-GTP complex dissociates from the beta-gamma heterodimer so that the subunits, in turn, may interact with and regulate effector molecules.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 7.1 kDa
• AA Sequence: MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Chemokine signaling pathway
• Full Length: Full L.

Gene Information

• Gene Name: GNG5 G protein subunit gamma 5 [ Homo sapiens (human) ]
• Official Symbol: GNG5
• Synonyms: FLJ92393
• Gene ID: 2787
• mRNA Refseq: NM_005274.3
• Protein Refseq: NP_005265.1
• MIM: 600874
• UniProt ID: P63218