Recombinant Full Length Human GNA14 Protein, GST-tagged

• Cat.No.: GNA14-5423HF
• Product Overview: Human GNA14 full-length ORF (BAG35367.1, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 355 amino acids
• Description: This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors
• Molecular Mass: 65.45 kDa
• AA Sequence: MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GNA14 guanine nucleotide binding protein (G protein), alpha 14 [ Homo sapiens ]
• Official Symbol: GNA14
• Synonyms: GNA14; guanine nucleotide binding protein (G protein), alpha 14; guanine nucleotide-binding protein subunit alpha-14; g alpha-14; G-protein subunit alpha-14; guanine nucleotide-binding protein 14
• Gene ID: 9630
• mRNA Refseq: NM_004297
• Protein Refseq: NP_004288
• MIM: 604397
• UniProt ID: O95837