Recombinant Full Length Human GNA14 Protein, GST-tagged

Cat.No. : GNA14-5423HF
Product Overview : Human GNA14 full-length ORF (BAG35367.1, 1 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 355 amino acids
Description : This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors
Molecular Mass : 65.45 kDa
AA Sequence : MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNA14 guanine nucleotide binding protein (G protein), alpha 14 [ Homo sapiens ]
Official Symbol GNA14
Synonyms GNA14; guanine nucleotide binding protein (G protein), alpha 14; guanine nucleotide-binding protein subunit alpha-14; g alpha-14; G-protein subunit alpha-14; guanine nucleotide-binding protein 14;
Gene ID 9630
mRNA Refseq NM_004297
Protein Refseq NP_004288
MIM 604397
UniProt ID O95837

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GNA14 Products

Required fields are marked with *

My Review for All GNA14 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon