Recombinant Full Length Human GMNN Protein, GST-tagged
Cat.No. : | GMNN-5413HF |
Product Overview : | Human GMNN full-length ORF ( NP_056979.1, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 209 amino acids |
Description : | This gene encodes a protein that plays a critical role in cell cycle regulation. The encoded protein inhibits DNA replication by binding to DNA replication factor Cdt1, preventing the incorporation of minichromosome maintenance proteins into the pre-replication complex. The encoded protein is expressed during the S and G2 phases of the cell cycle and is degraded by the anaphase-promoting complex during the metaphase-anaphase transition. Increased expression of this gene may play a role in several malignancies including colon, rectal and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and two pseudogenes of this gene are located on the short arm of chromosome 16. [provided by RefSeq, Oct 2011] |
Molecular Mass : | 50 kDa |
AA Sequence : | MNPSMKQKQEEIKENIKNSSVPRRTLKMIQPSASGSLVGRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GMNN geminin, DNA replication inhibitor [ Homo sapiens ] |
Official Symbol | GMNN |
Synonyms | GMNN; geminin, DNA replication inhibitor; geminin; Gem; |
Gene ID | 51053 |
mRNA Refseq | NM_001251989 |
Protein Refseq | NP_001238918 |
MIM | 602842 |
UniProt ID | O75496 |
◆ Recombinant Proteins | ||
GMNN-1885R | Recombinant Rhesus monkey GMNN Protein, His-tagged | +Inquiry |
GMNN-2691C | Recombinant Chicken GMNN | +Inquiry |
GMNN-353H | Recombinant Human Geminin, DNA Replication Inhibitor, His-tagged | +Inquiry |
GMNN-5413HF | Recombinant Full Length Human GMNN Protein, GST-tagged | +Inquiry |
Gmnn-7839R | Recombinant Rat Gmnn protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GMNN-5880HCL | Recombinant Human GMNN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GMNN Products
Required fields are marked with *
My Review for All GMNN Products
Required fields are marked with *
0
Inquiry Basket