Recombinant Rat Gmfb Protein (141 aa)

• Cat.No.: Gmfb-034G
• Product Overview: Recombinant Rat Gmfb Protein without tag was expressed in E. coli.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 141
• Description: Glia maturation factor beta(GMF-β) coded by GMFb gene at chromosome 14 in mouse, is identical to human GMF-β, with the exception of two amino acid residues. It is a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family, and plays an important role in the upstream regulation of excessive production and the releasing of proinflammatory cytokines/chemokines in brain cells, leading to the destruction of oligodendrocytes, the myelin forming cells, and neurons.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Data not available.
• Molecular Mass: Approximately 16.4 KDa, a single non-glycosylated polypeptide chain containing 141 amino acid residues.
• AA Sequence: SESLVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
• Endotoxin: Less than 1 EU/μg of rMuGMF-β as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Gmfb glia maturation factor, beta [ Rattus norvegicus ]
• Official Symbol: Gmfb
• Synonyms: GMFB; glia maturation factor, beta; glia maturation factor beta; GMF-beta; DNA for thyroid hormone receptor binding site (276bp); MGC93372
• Gene ID: 81661
• mRNA Refseq: NM_031032
• Protein Refseq: NP_112294
• UniProt ID: Q63228