Recombinant Full Length Human GLB1 Protein, C-Flag-tagged
Cat.No. : | GLB1-417HFL |
Product Overview : | Recombinant Full Length Human GLB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the glycosyl hydrolase 35 family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature lysosomal enzyme. This enzyme catalyzes the hydrolysis of a terminal beta-linked galactose residue from ganglioside substrates and other glycoconjugates. Mutations in this gene may result in GM1-gangliosidosis and Morquio B syndrome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 75.9 kDa |
AA Sequence : | MPGFLVRILLLLLVLLLLGPTRGLRNATQRMFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLL KMKMAGLNAIQTYVPWNFHEPWPGQYQFSEDHDVEYFLRLAHELGLLVILRPGPYICAEWEMGGLPAWLL EKESILLRSSDPDYLAAVDKWLGVLLPKMKPLLYQNGGPVITVQVENEYGSYFACDFDYLRFLQKRFRHH LGDDVVLFTTDGAHKTFLKCGALQGLYTTVDFGTGSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQP HSTIKTEAVASSLYDILARGASVNLYMFIGGTNFAYWNGANSPYAAQPTSYDYDAPLSEAGDLTEKYFAL RNIIQKFEKVPEGPIPPSTPKFAYGKVTLEKLKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRT TLPQDCSNPAPLSSPLNGVHDRAYVAVDGIPQGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYIN DFKGLVSNLTLSSNILTDWTIFPLDTEDAVRSHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPS GIPDLPQDTFIQFPGWTKGQVWINGFNLGRYWPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDD PELCAVTFVDRPVIGSSVTYDHPSKPVEKRLMPPPPQKNKDSWLDHVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Galactose metabolism, Glycosaminoglycan degradation, Glycosphingolipid biosynthesis - ganglio series, Lysosome, Metabolic pathways, Other glycan degradation, Sphingolipid metabolism |
Full Length : | Full L. |
Gene Name | GLB1 galactosidase beta 1 [ Homo sapiens (human) ] |
Official Symbol | GLB1 |
Synonyms | EBP; ELNR1; MPS4B |
Gene ID | 2720 |
mRNA Refseq | NM_000404.4 |
Protein Refseq | NP_000395.3 |
MIM | 611458 |
UniProt ID | P16278 |
◆ Recombinant Proteins | ||
GLB1-180H | Recombinant Human GLB1 Protein, His-tagged | +Inquiry |
Glb1-182R | Recombinant Rat Glb1 Protein, His-tagged | +Inquiry |
GLB1-984H | Recombinant Human GLB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLB1-7790H | Active Recombinant Human GLB1, His-tagged | +Inquiry |
GLB1-5396C | Recombinant Chicken GLB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLB1-5910HCL | Recombinant Human GLB1 293 Cell Lysate | +Inquiry |
GLB1-5909HCL | Recombinant Human GLB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLB1 Products
Required fields are marked with *
My Review for All GLB1 Products
Required fields are marked with *
0
Inquiry Basket