Recombinant Full Length Human GJA4 Protein
Cat.No. : | GJA4-191HF |
Product Overview : | Recombinant full length protein Human Connexin 37 / GJA4 with a N terminal proprietary tag: predicted molecular weight 62.70 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 333 amino acids |
Description : | This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. |
Form : | Liquid |
Molecular Mass : | 62.700kDa inclusive of tags |
AA Sequence : | MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLA GESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVL QFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKD PQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVL CKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFV SRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGM RARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPT YNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPP SRPSSSASKKQYV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | GJA4 gap junction protein, alpha 4, 37kDa [ Homo sapiens ] |
Official Symbol | GJA4 |
Synonyms | GJA4; gap junction protein, alpha 4, 37kDa; gap junction protein, alpha 4, 37kD (connexin 37) , gap junction protein, alpha 4, 37kDa (connexin 37); gap junction alpha-4 protein; connexin 37; CX37 |
Gene ID | 2701 |
mRNA Refseq | NM_002060 |
Protein Refseq | NP_002051 |
MIM | 121012 |
UniProt ID | P35212 |
◆ Recombinant Proteins | ||
GJA4-2547R | Recombinant Rat GJA4 Protein | +Inquiry |
GJA4-4922H | Recombinant Human GJA4 Protein, GST-tagged | +Inquiry |
GJA4-5291HF | Recombinant Full Length Human GJA4 Protein, GST-tagged | +Inquiry |
RFL12524RF | Recombinant Full Length Rat Gap Junction Alpha-4 Protein(Gja4) Protein, His-Tagged | +Inquiry |
GJA4-191HF | Recombinant Full Length Human GJA4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJA4-5922HCL | Recombinant Human GJA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GJA4 Products
Required fields are marked with *
My Review for All GJA4 Products
Required fields are marked with *
0
Inquiry Basket