Recombinant Human GJA4
| Cat.No. : | GJA4-26253TH |
| Product Overview : | Recombinant full length protein Human Connexin 37 / GJA4 with a N terminal proprietary tag: predicted molecular weight 62.70 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | This gene encodes a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction. |
| Protein length : | 333 amino acids |
| Molecular Weight : | 62.700kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Expressed in multiple organs and tissues, including heart, uterus, ovary, and blood vessel endothelium. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MGDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLA GESVWGDEQSDFECNTAQPGCTNVCYDQAFPISHIRYWVL QFLFVSTPTLVYLGHVIYLSRREERLRQKEGELRALPAKD PQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVASVL CKSVLEAGFLYGQWRLYGWTMEPVFVCQRAPCPYLVDCFV SRPTEKTIFIIFMLVVGLISLVLNLLELVHLLCRCLSRGM RARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPT YNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPP SRPSSSASKKQYV |
| Sequence Similarities : | Belongs to the connexin family. Alpha-type (group II) subfamily. |
| Tag : | Non |
| Gene Name | GJA4 gap junction protein, alpha 4, 37kDa [ Homo sapiens ] |
| Official Symbol | GJA4 |
| Synonyms | GJA4; gap junction protein, alpha 4, 37kDa; gap junction protein, alpha 4, 37kD (connexin 37) , gap junction protein, alpha 4, 37kDa (connexin 37); gap junction alpha-4 protein; connexin 37; CX37; |
| Gene ID | 2701 |
| mRNA Refseq | NM_002060 |
| Protein Refseq | NP_002051 |
| MIM | 121012 |
| Uniprot ID | P35212 |
| Chromosome Location | 1p35.1 |
| Pathway | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Gap junction assembly, organism-specific biosystem; Gap junction trafficking, organism-specific biosystem; Gap junction trafficking and regulation, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GJA4 Products
Required fields are marked with *
My Review for All GJA4 Products
Required fields are marked with *
0
Inquiry Basket
