Recombinant Full Length Human GIMAP7 Protein, GST-tagged

• Cat.No.: GIMAP7-5260HF
• Product Overview: Human GIMAP7 full-length ORF ( NP_694968.1, 1 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 60.9 kDa
• Protein length: 300 amino acids
• AA Sequence: MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GIMAP7 GTPase, IMAP family member 7 [ Homo sapiens ]
• Official Symbol: GIMAP7
• Synonyms: GIMAP7; GTPase, IMAP family member 7; GTPase IMAP family member 7; IAN7; MGC27027; IAN-7; immune associated nucleotide; immunity-associated nucleotide 7 protein; hIAN7
• Gene ID: 168537
• mRNA Refseq: NM_153236
• Protein Refseq: NP_694968
• MIM: 616961
• UniProt ID: Q8NHV1