Recombinant Full Length Human GIMAP6 Protein, GST-tagged

• Cat.No.: GIMAP6-5259HF
• Product Overview: Human GIMAP6 full-length ORF ( NP_078987.3, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 292 amino acids
• Description: This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene. [provided by RefSeq
• Molecular Mass: 59.3 kDa
• AA Sequence: MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GIMAP6 GTPase, IMAP family member 6 [ Homo sapiens ]
• Official Symbol: GIMAP6
• Synonyms: GIMAP6; GTPase, IMAP family member 6; GTPase IMAP family member 6; FLJ22690; immune associated nucleotide 2; immune associated nucleotide 6; IAN2; IAN6; IAN-2; IAN-6; DKFZp686A01175
• Gene ID: 474344
• mRNA Refseq: NM_001244071
• Protein Refseq: NP_001231000
• MIM: 616960
• UniProt ID: Q6P9H5