Recombinant Full Length Human Gilles De La Tourette Syndrome Chromosomal Region Candidate Gene 1 Protein(Gtscr1) Protein, His-Tagged
Cat.No. : | RFL215HF |
Product Overview : | Recombinant Full Length Human Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein(GTSCR1) Protein (Q86UQ5) (1-136aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-136) |
Form : | Lyophilized powder |
AA Sequence : | MQSDIYHPGHSFPSWVLCKVTYTILATASQVGSFARKTHQNGDLQIRGGRGRRESTEIFQ VASVTEGEESPPAICMEVFLFLWFIAPIYACVCRIFKIQVRNTVKNSSTASLAPSISTSE ERQIRIERHHYHLYGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GTSCR1 |
Synonyms | GTSCR1; Gilles de la Tourette syndrome chromosomal region candidate gene 1 protein |
UniProt ID | Q86UQ5 |
◆ Recombinant Proteins | ||
ZNF330-12552Z | Recombinant Zebrafish ZNF330 | +Inquiry |
GAD1-615H | Recombinant Human glutamate decarboxylase 1 (brain, 67kDa), His-tagged | +Inquiry |
PCK1-3961R | Recombinant Rat PCK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL22863DF | Recombinant Full Length Draba Nemorosa Atp Synthase Subunit B, Chloroplastic(Atpf) Protein, His-Tagged | +Inquiry |
BHLHE40-10221H | Recombinant Human BHLHE40, His-tagged | +Inquiry |
◆ Native Proteins | ||
Tf-264R | Native Rat Transferrin | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
ALPL-66C | Active Native Calf Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP5-8939HCL | Recombinant Human AKAP5 293 Cell Lysate | +Inquiry |
ANXA2-8834HCL | Recombinant Human ANXA2 293 Cell Lysate | +Inquiry |
GLOD4-212HCL | Recombinant Human GLOD4 cell lysate | +Inquiry |
EPHX1-6586HCL | Recombinant Human EPHX1 293 Cell Lysate | +Inquiry |
PLP2-3098HCL | Recombinant Human PLP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GTSCR1 Products
Required fields are marked with *
My Review for All GTSCR1 Products
Required fields are marked with *
0
Inquiry Basket