Recombinant Full Length Human GCNT2 Protein, GST-tagged

Cat.No. : GCNT2-5186HF
Product Overview : Human GCNT2 full-length ORF ( NP_663630.2, 1 a.a. - 402 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq
Molecular Mass : 72.9 kDa
Protein length : 402 amino acids
AA Sequence : MNFWRYCFFAFTLLSVVIFVRFYSSQLSPPKSYEKLNSSSERYFRKTACNHALEKMPVFLWENILPSPLRSVPCKDYLTQNHYITSPLSEEEAAFPLAYVMVIHKDFDTFERLFRAIYMPQNVYCVHVDEKAPAEYKESVRQLLSCFQNAFIASKTESVVYAGISRLQADLNCLKDLVASEVPWKYVINTCGQDFPLKTNREIVQHLKGFKGKNITPGVLPPDHAIKRTKYVHQEHTDKGGFFVKNTNILKTSPPHQLTIYFGTAYVALTRDFVDFVLRDQRAIDLLQWSKDTYSPDEHFWVTLNRVSGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) [ Homo sapiens ]
Official Symbol GCNT2
Synonyms GCNT2; glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group); cataract, congenital, CCAT, GCNT5, glucosaminyl (N acetyl) transferase 2, I branching enzyme, glucosaminyl (N acetyl) transferase 2, I branching enzyme (Ii blood group), glucosaminyl (N acetyl) transferase 5, II, NACGT1; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; bA360O19.2; bA421M1.1; IGNT; Ii blood group; NAGCT1; ULG3; unassigned linkage group 3; I beta-1,6-N-acetylglucosaminyltransferase; beta-1,6-N-acetylglucosaminyltransferase 2; II; CCAT; GCNT5; GCNT2C; NACGT1; MGC163396;
Gene ID 2651
mRNA Refseq NM_001491
Protein Refseq NP_001482
MIM 600429
UniProt ID Q06430

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GCNT2 Products

Required fields are marked with *

My Review for All GCNT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon